PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g12880.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NF-YA
Protein Properties Length: 174aa    MW: 18899.3 Da    PI: 10.4401
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g12880.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA108.36e-3470126158
                       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                     +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh+hA++R+Rg+gGrF
  Zjn_sc00002.1.g12880.1.am.mkhc  70 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHQHAMKRARGTGGRF 126
                                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.6E-3968129IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.35169129IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-2971126IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-257294IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068607494IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.9E-25103126IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MMSALSLGNP ATYAHQKSDR SQSYAKAYPY ADSFFGGAVA TYGSHAIMHP QIVGMVPSSR  60
VPLPIEPAAE EPIYVNAKQY HAILRRRQLR AKLEAENKLV KSRKPYLHES RHQHAMKRAR  120
GTGGRFLNTK QQQAEAAGGG SSDAPANNGG GLFSKHEYSL PPGDLRYHAR GGGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2470134266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985518.11e-97PREDICTED: nuclear transcription factor Y subunit A-7 isoform X4
RefseqXP_004985516.11e-97PREDICTED: nuclear transcription factor Y subunit A-7 isoform X2
SwissprotQ93ZH26e-40NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLK4AEG22e-97K4AEG2_SETIT; Uncharacterized protein
TrEMBLK4AEK61e-97K4AEK6_SETIT; Uncharacterized protein
TrEMBLK4AET11e-97K4AET1_SETIT; Uncharacterized protein
STRINGSi037269m5e-97(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.16e-37nuclear factor Y, subunit A3